Fragment or analogue
TB-500
Thymosin beta-4
Thymosin beta-4 is a 43-residue peptide. PubChem CID 45382195 matches the acetylated sequence stored on this page. Catalogs and papers also use TB-500 for shorter fragments, so the names are not automatically the same molecule.
Record
- Research status
- Fragment or analogue
- Classification
- Endogenous thymic peptide
- One-letter sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Display sequence
- Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Length
- 43 residues
- Molecular formula
- C212H350N56O78S
- Molecular weight
- 4963
- CAS number
- Not verified
- PubChem CID
- 45382195
- Sequence database
- Not verified
Naming
This record stores acetylated thymosin beta-4 because that is the 43-residue registry entry. It does not claim that every vial labeled TB-500 is that full sequence. Shorter fragments that include the actin-binding region are different molecules.
What this record does not claim
The formula matches the acetylated 43-residue sequence, not an unverified fragment. Treat a supplier’s “TB-500” label as a name to reconcile against the sequence, not as proof of this record.
Categories
Sources
Last reviewed October 13, 2026. Send a correction